SATB2 polyclonal antibody
  • SATB2 polyclonal antibody

SATB2 polyclonal antibody

Ref: AB-PAB27844
SATB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SATB2.
Información adicional
Size 100 uL
Gene Name SATB2
Gene Alias FLJ21474|FLJ32076|KIAA1034|MGC119474|MGC119477
Gene Description SATB homeobox 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSPQLSPQLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SATB2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 23314
Iso type IgG

Enviar un mensaje


SATB2 polyclonal antibody

SATB2 polyclonal antibody