C1orf173 polyclonal antibody
  • C1orf173 polyclonal antibody

C1orf173 polyclonal antibody

Ref: AB-PAB27842
C1orf173 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf173.
Información adicional
Size 100 uL
Gene Name C1orf173
Gene Alias DKFZp547I048|DKFZp761G1720|DKFZp781L0319|MGC90412|RP11-653A5.1
Gene Description chromosome 1 open reading frame 173
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DTGPMEDTASKREDGSEEAILGGEEPAKERKEVMRTETRLSPFTGEAEASRMQVSEGSPEEGSLAKEAFLCKEDVEGEEMVTEAEANREDDRKEILPKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf173.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 127254
Iso type IgG

Enviar un mensaje


C1orf173 polyclonal antibody

C1orf173 polyclonal antibody