ZNF674 polyclonal antibody
  • ZNF674 polyclonal antibody

ZNF674 polyclonal antibody

Ref: AB-PAB27521
ZNF674 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF674.
Información adicional
Size 100 uL
Gene Name ZNF674
Gene Alias DKFZp686H0940|MRX92|ZNF673B
Gene Description zinc finger family member 674
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq IKHQRTHTGEKPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTTSSLIYQRIHTSEKPQCSEHGKASDEKPSPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF674.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 641339
Iso type IgG

Enviar un mensaje


ZNF674 polyclonal antibody

ZNF674 polyclonal antibody