LEKR1 polyclonal antibody
  • LEKR1 polyclonal antibody

LEKR1 polyclonal antibody

Ref: AB-PAB27520
LEKR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LEKR1.
Información adicional
Size 100 uL
Gene Name LEKR1
Gene Alias FLJ16641|FLJ37161
Gene Description leucine, glutamate and lysine rich 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KLHKSHIRYTEESNSKEKEIENLKNLVAEFESRLKKEIDSNDSVSENLRKEMEQKSDELKRVMLAQTQLIEQFNQSQEENTFLQETVRRECEERFEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LEKR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389170
Iso type IgG

Enviar un mensaje


LEKR1 polyclonal antibody

LEKR1 polyclonal antibody