SAC3D1 polyclonal antibody
  • SAC3D1 polyclonal antibody

SAC3D1 polyclonal antibody

Ref: AB-PAB27519
SAC3D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAC3D1.
Información adicional
Size 100 uL
Gene Name SAC3D1
Gene Alias HSU79266|SHD1
Gene Description SAC3 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AFREGNAARLFRLLQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGEERVVFLRGRYVEEGLPPASTCKVLVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAC3D1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 29901
Iso type IgG

Enviar un mensaje


SAC3D1 polyclonal antibody

SAC3D1 polyclonal antibody