LRRC68 polyclonal antibody
  • LRRC68 polyclonal antibody

LRRC68 polyclonal antibody

Ref: AB-PAB27517
LRRC68 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC68.
Información adicional
Size 100 uL
Gene Name LRRC68
Gene Alias KIAA1986
Gene Description leucine rich repeat containing 68
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TVDEVIGAYKQACQKLNCRQIPKLLRQLQEFTDLGHRLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC68.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 284352
Iso type IgG

Enviar un mensaje


LRRC68 polyclonal antibody

LRRC68 polyclonal antibody