PZP polyclonal antibody
  • PZP polyclonal antibody

PZP polyclonal antibody

Ref: AB-PAB27516
PZP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PZP.
Información adicional
Size 100 uL
Gene Name PZP
Gene Alias CPAMD6|MGC133093
Gene Description pregnancy-zone protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QFSINTTSISVNKLFVRVFTVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETITAHYT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PZP.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 5858
Iso type IgG

Enviar un mensaje


PZP polyclonal antibody

PZP polyclonal antibody