WIPF3 polyclonal antibody
  • WIPF3 polyclonal antibody

WIPF3 polyclonal antibody

Ref: AB-PAB27513
WIPF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WIPF3.
Información adicional
Size 100 uL
Gene Name WIPF3
Gene Alias CR16|FLJ36931
Gene Description WAS/WASL interacting protein family, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WIPF3.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 644150
Iso type IgG

Enviar un mensaje


WIPF3 polyclonal antibody

WIPF3 polyclonal antibody