TBC1D30 polyclonal antibody
  • TBC1D30 polyclonal antibody

TBC1D30 polyclonal antibody

Ref: AB-PAB27509
TBC1D30 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D30.
Información adicional
Size 100 uL
Gene Name TBC1D30
Gene Alias KIAA0984
Gene Description TBC1 domain family, member 30
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NSSPVINHLLLGKKMKMTNRAAKNAVIHIPGHTGGKISPVPYEDLKTKLNSPWRTHIRVHKKNMPRTKSHPGCGDTVGLIDEQNEASKTNGLG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D30.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 23329
Iso type IgG

Enviar un mensaje


TBC1D30 polyclonal antibody

TBC1D30 polyclonal antibody