CEP192 polyclonal antibody
  • CEP192 polyclonal antibody

CEP192 polyclonal antibody

Ref: AB-PAB27508
CEP192 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP192.
Información adicional
Size 100 uL
Gene Name CEP192
Gene Alias -
Gene Description centrosomal protein 192kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FVLKERTQENVTLIYNPSDRGINNKTATELSTVYLFGGDEISRQQYRRALLHKPEMIKQILPEHSVLQNINFVEAFQDELLVTEVYD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP192.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 55125
Iso type IgG

Enviar un mensaje


CEP192 polyclonal antibody

CEP192 polyclonal antibody