VWA5B2 polyclonal antibody
  • VWA5B2 polyclonal antibody

VWA5B2 polyclonal antibody

Ref: AB-PAB27503
VWA5B2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VWA5B2.
Información adicional
Size 100 uL
Gene Name VWA5B2
Gene Alias -
Gene Description von Willebrand factor A domain containing 5B2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VWA5B2.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 90113
Iso type IgG

Enviar un mensaje


VWA5B2 polyclonal antibody

VWA5B2 polyclonal antibody