METTL8 polyclonal antibody
  • METTL8 polyclonal antibody

METTL8 polyclonal antibody

Ref: AB-PAB27501
METTL8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant METTL8.
Información adicional
Size 100 uL
Gene Name METTL8
Gene Alias FLJ13334|FLJ13984|FLJ31054|FLJ42098|FLJ77788|TIP
Gene Description methyltransferase like 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human METTL8.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 79828
Iso type IgG

Enviar un mensaje


METTL8 polyclonal antibody

METTL8 polyclonal antibody