NT5C3L polyclonal antibody
  • NT5C3L polyclonal antibody

NT5C3L polyclonal antibody

Ref: AB-PAB27499
NT5C3L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NT5C3L.
Información adicional
Size 100 uL
Gene Name NT5C3L
Gene Alias MGC20781|MGC21375
Gene Description 5'-nucleotidase, cytosolic III-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GKRCPSSYNILDNSKIISEECRKELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVRESNAMLREGYKTFFNTLYHNNIPLFIFSAGIGDILEEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NT5C3L.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 115024
Iso type IgG

Enviar un mensaje


NT5C3L polyclonal antibody

NT5C3L polyclonal antibody