ZNF227 polyclonal antibody
  • ZNF227 polyclonal antibody

ZNF227 polyclonal antibody

Ref: AB-PAB27498
ZNF227 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF227.
Información adicional
Size 100 uL
Gene Name ZNF227
Gene Alias -
Gene Description zinc finger protein 227
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF227.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 7770
Iso type IgG

Enviar un mensaje


ZNF227 polyclonal antibody

ZNF227 polyclonal antibody