EGR4 polyclonal antibody
  • EGR4 polyclonal antibody

EGR4 polyclonal antibody

Ref: AB-PAB27496
EGR4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EGR4.
Información adicional
Size 100 uL
Gene Name EGR4
Gene Alias NGFI-C|NGFIC|PAT133
Gene Description early growth response 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EGR4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1961
Iso type IgG

Enviar un mensaje


EGR4 polyclonal antibody

EGR4 polyclonal antibody