ZNF678 polyclonal antibody
  • ZNF678 polyclonal antibody

ZNF678 polyclonal antibody

Ref: AB-PAB27494
ZNF678 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF678.
Información adicional
Size 100 uL
Gene Name ZNF678
Gene Alias MGC42493
Gene Description zinc finger protein 678
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLCIGVCAFEGANTSTSFYKLVYTAILSYSIQDLLPEQDMKDLCQKVTLTRHRSWGLDNLHLVKDWRTVNEGKGQKEY
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF678.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 339500
Iso type IgG

Enviar un mensaje


ZNF678 polyclonal antibody

ZNF678 polyclonal antibody