KCNJ12 polyclonal antibody
  • KCNJ12 polyclonal antibody

KCNJ12 polyclonal antibody

Ref: AB-PAB27489
KCNJ12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNJ12.
Información adicional
Size 100 uL
Gene Name KCNJ12
Gene Alias FLJ14167|IRK2|KCNJN1|Kir2.2|Kir2.2v|hIRK|hIRK1|hkir2.2x|kcnj12x
Gene Description potassium inwardly-rectifying channel, subfamily J, member 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNJ12.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 3768
Iso type IgG

Enviar un mensaje


KCNJ12 polyclonal antibody

KCNJ12 polyclonal antibody