STARD9 polyclonal antibody
  • STARD9 polyclonal antibody

STARD9 polyclonal antibody

Ref: AB-PAB27488
STARD9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STARD9.
Información adicional
Size 100 uL
Gene Name STARD9
Gene Alias DKFZp781J069|FLJ16106|FLJ21936|KIAA1300
Gene Description StAR-related lipid transfer (START) domain containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQGPHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKPQFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQEEEQHRDQASGGGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STARD9.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 57519
Iso type IgG

Enviar un mensaje


STARD9 polyclonal antibody

STARD9 polyclonal antibody