SLC10A5 polyclonal antibody
  • SLC10A5 polyclonal antibody

SLC10A5 polyclonal antibody

Ref: AB-PAB27487
SLC10A5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC10A5.
Información adicional
Size 100 uL
Gene Name SLC10A5
Gene Alias P5
Gene Description solute carrier family 10 (sodium/bile acid cotransporter family), member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDRNILMLILPLILLNKCAFGCKIEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC10A5.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 347051
Iso type IgG

Enviar un mensaje


SLC10A5 polyclonal antibody

SLC10A5 polyclonal antibody