MUC12 polyclonal antibody
  • MUC12 polyclonal antibody

MUC12 polyclonal antibody

Ref: AB-PAB27483
MUC12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MUC12.
Información adicional
Size 100 uL
Gene Name MUC12
Gene Alias MUC11
Gene Description mucin 12, cell surface associated
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MUC12.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 10071
Iso type IgG

Enviar un mensaje


MUC12 polyclonal antibody

MUC12 polyclonal antibody