FBF1 polyclonal antibody
  • FBF1 polyclonal antibody

FBF1 polyclonal antibody

Ref: AB-PAB27482
FBF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBF1.
Información adicional
Size 100 uL
Gene Name FBF1
Gene Alias Alb|FBF-1|FLJ00103
Gene Description Fas (TNFRSF6) binding factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBF1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 85302
Iso type IgG

Enviar un mensaje


FBF1 polyclonal antibody

FBF1 polyclonal antibody