PINX1 polyclonal antibody
  • PINX1 polyclonal antibody

PINX1 polyclonal antibody

Ref: AB-PAB27480
PINX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PINX1.
Información adicional
Size 100 uL
Gene Name PINX1
Gene Alias FLJ20565|LPTL|LPTS|MGC8850
Gene Description PIN2-interacting protein 1
Storage Conditions Store at 4C for short term storage. For long term storage, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PINX1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide).
Gene ID 54984
Iso type IgG

Enviar un mensaje


PINX1 polyclonal antibody

PINX1 polyclonal antibody