NSUN7 polyclonal antibody
  • NSUN7 polyclonal antibody

NSUN7 polyclonal antibody

Ref: AB-PAB27477
NSUN7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NSUN7.
Información adicional
Size 100 uL
Gene Name NSUN7
Gene Alias FLJ14001
Gene Description NOL1/NOP2/Sun domain family, member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SEVQEVENLLNSFKIKLAAALARCRIKHDALSIYHILPETVRKQELRASTLPLYAWINTCKISPEEVYNNLKRRGYNKVKSVLHIDDKVFAVDQHCYDVLIFPSHLKNDLINIDLFKDYKLIFQDKSRSLA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NSUN7.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 79730
Iso type IgG

Enviar un mensaje


NSUN7 polyclonal antibody

NSUN7 polyclonal antibody