SELM polyclonal antibody
  • SELM polyclonal antibody

SELM polyclonal antibody

Ref: AB-PAB27474
SELM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SELM.
Información adicional
Size 100 uL
Gene Name SELM
Gene Alias MGC40146|SEPM
Gene Description selenoprotein M
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SELM.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 140606
Iso type IgG

Enviar un mensaje


SELM polyclonal antibody

SELM polyclonal antibody