DNAJC25 polyclonal antibody
  • DNAJC25 polyclonal antibody

DNAJC25 polyclonal antibody

Ref: AB-PAB27473
DNAJC25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC25.
Información adicional
Size 100 uL
Gene Name DNAJC25
Gene Alias bA16L21.2.1
Gene Description DnaJ (Hsp40) homolog, subfamily C , member 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (0.25-2 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC25.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 548645
Iso type IgG

Enviar un mensaje


DNAJC25 polyclonal antibody

DNAJC25 polyclonal antibody