HIGD2BP polyclonal antibody
  • HIGD2BP polyclonal antibody

HIGD2BP polyclonal antibody

Ref: AB-PAB27471
HIGD2BP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HIGD2BP.
Información adicional
Size 100 uL
Gene Name HIGD2BP
Gene Alias -
Gene Description HIG1 domain family, member 2B pseudogene
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HIGD2BP.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 123346
Iso type IgG

Enviar un mensaje


HIGD2BP polyclonal antibody

HIGD2BP polyclonal antibody