CDH26 polyclonal antibody
  • CDH26 polyclonal antibody

CDH26 polyclonal antibody

Ref: AB-PAB27470
CDH26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDH26.
Información adicional
Size 100 uL
Gene Name CDH26
Gene Alias VR20
Gene Description cadherin-like 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVELADAEVGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDH26.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 60437
Iso type IgG

Enviar un mensaje


CDH26 polyclonal antibody

CDH26 polyclonal antibody