GLOD5 polyclonal antibody
  • GLOD5 polyclonal antibody

GLOD5 polyclonal antibody

Ref: AB-PAB27465
GLOD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLOD5.
Información adicional
Size 100 uL
Gene Name GLOD5
Gene Alias -
Gene Description glyoxalase domain containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLOD5.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 392465
Iso type IgG

Enviar un mensaje


GLOD5 polyclonal antibody

GLOD5 polyclonal antibody