MAGED4B polyclonal antibody
  • MAGED4B polyclonal antibody

MAGED4B polyclonal antibody

Ref: AB-PAB27461
MAGED4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAGED4B.
Información adicional
Size 100 uL
Gene Name MAGED4B
Gene Alias MGC3210|MGC88639
Gene Description melanoma antigen family D, 4B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AEGSFSVQSESYSVEDMDEGSDEVGEEEMVEGNDYEEFGAFGGYGTLTSFDIHILRAFGSLGPGLRILSNEPWELENPVLAQTLVEALQLDPETLANETAARAANVARAAASNRAA
Form Liquid
Recomended Dilution Immunohistochemistry (1200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAGED4B.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 81557
Iso type IgG

Enviar un mensaje


MAGED4B polyclonal antibody

MAGED4B polyclonal antibody