MGAM polyclonal antibody
  • MGAM polyclonal antibody

MGAM polyclonal antibody

Ref: AB-PAB27460
MGAM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MGAM.
Información adicional
Size 100 uL
Gene Name MGAM
Gene Alias MG|MGA
Gene Description maltase-glucoamylase (alpha-glucosidase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MGAM.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 8972
Iso type IgG

Enviar un mensaje


MGAM polyclonal antibody

MGAM polyclonal antibody