LGALS7 polyclonal antibody
  • LGALS7 polyclonal antibody

LGALS7 polyclonal antibody

Ref: AB-PAB27459
LGALS7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LGALS7.
Información adicional
Size 100 uL
Gene Name LGALS7
Gene Alias GAL7|LGALS7A
Gene Description lectin, galactoside-binding, soluble, 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (0.04-0.4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LGALS7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3963
Iso type IgG

Enviar un mensaje


LGALS7 polyclonal antibody

LGALS7 polyclonal antibody