RIMBP3 polyclonal antibody
  • RIMBP3 polyclonal antibody

RIMBP3 polyclonal antibody

Ref: AB-PAB27458
RIMBP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RIMBP3.
Información adicional
Size 100 uL
Gene Name RIMBP3
Gene Alias DKFZp434H0735|KIAA1666|RIMBP3.1|RIMBP3A
Gene Description RIMS binding protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RDTASEVDDLEPDSVSLALEMGGSAAPAAPKLKIFMAQYNYNPFEGPNDHPEGELPLTAGDYIYIFGDMDEDGFYEGELEDGRRGLVPSNFVEQIPDSYIPGCLPAKSPDLGPSQLPAGQDEALEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RIMBP3.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 85376
Iso type IgG

Enviar un mensaje


RIMBP3 polyclonal antibody

RIMBP3 polyclonal antibody