EMID1 polyclonal antibody
  • EMID1 polyclonal antibody

EMID1 polyclonal antibody

Ref: AB-PAB27457
EMID1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EMID1.
Información adicional
Size 100 uL
Gene Name EMID1
Gene Alias EMI5|EMU1|MGC50657|hEmu1
Gene Description EMI domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RNWCSYVVTRTISCHVQNGTYLQRVLQNCPWPMSCPGSSYRTVVRPTYKVMYKIVTAREWRCCPGHSGVSCEEVAASSASLEPMWSGSTMRRMALRPTAFSGCLNCSKVSELTERLKVLEAKMTMLTVIEQPVPPTPAT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EMID1.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 129080
Iso type IgG

Enviar un mensaje


EMID1 polyclonal antibody

EMID1 polyclonal antibody