ZNF275 polyclonal antibody
  • ZNF275 polyclonal antibody

ZNF275 polyclonal antibody

Ref: AB-PAB27456
ZNF275 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF275.
Información adicional
Size 100 uL
Gene Name ZNF275
Gene Alias -
Gene Description zinc finger protein 275
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq WECGDCGKVFRGVAEFNEHRKSHVAAEPQPGPSRALENAAEKREQMEREAKPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRSFKVNTHLFRHQKLHTSEKPFACKACSRDF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF275.
Storage Buffer In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene ID 10838
Iso type IgG

Enviar un mensaje


ZNF275 polyclonal antibody

ZNF275 polyclonal antibody