SLC15A3 polyclonal antibody
  • SLC15A3 polyclonal antibody

SLC15A3 polyclonal antibody

Ref: AB-PAB24545
SLC15A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC15A3.
Información adicional
Size 100 uL
Gene Name SLC15A3
Gene Alias FLJ26631|OCTP|PHT2|PTR3|hPTR3
Gene Description solute carrier family 15, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC15A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51296
Iso type IgG

Enviar un mensaje


SLC15A3 polyclonal antibody

SLC15A3 polyclonal antibody