DEFB116 polyclonal antibody
  • DEFB116 polyclonal antibody

DEFB116 polyclonal antibody

Ref: AB-PAB24538
DEFB116 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DEFB116.
Información adicional
Size 100 uL
Gene Name DEFB116
Gene Alias DEFB-16
Gene Description defensin, beta 116
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DEFB116.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 245930
Iso type IgG

Enviar un mensaje


DEFB116 polyclonal antibody

DEFB116 polyclonal antibody