OAF polyclonal antibody
  • OAF polyclonal antibody

OAF polyclonal antibody

Ref: AB-PAB24535
OAF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OAF.
Información adicional
Size 100 uL
Gene Name OAF
Gene Alias MGC52117|NS5ATP13TP2
Gene Description OAF homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RFWLEQGVDSSVFEALPKASEQAELPRCRQVGDRGKPCVCHYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OAF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 220323
Iso type IgG

Enviar un mensaje


OAF polyclonal antibody

OAF polyclonal antibody