ZFP57 polyclonal antibody
  • ZFP57 polyclonal antibody

ZFP57 polyclonal antibody

Ref: AB-PAB24530
ZFP57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZFP57.
Información adicional
Size 100 uL
Gene Name ZFP57
Gene Alias C6orf40|TNDM1|ZNF698|bA145L22|bA145L22.2
Gene Description zinc finger protein 57 homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZFP57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 346171
Iso type IgG

Enviar un mensaje


ZFP57 polyclonal antibody

ZFP57 polyclonal antibody