FAM186A polyclonal antibody
  • FAM186A polyclonal antibody

FAM186A polyclonal antibody

Ref: AB-PAB24529
FAM186A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM186A.
Información adicional
Size 100 uL
Gene Name FAM186A
Gene Alias -
Gene Description family with sequence similarity 186, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ETVTKILRKYKDTKKEEQVGEKPIKQKKVVSFMPGLHFQKSPISAKSESSTLLSYESTDPVINNLIQMILAEIESERDIPTVSTVQKDHKEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM186A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 121006
Iso type IgG

Enviar un mensaje


FAM186A polyclonal antibody

FAM186A polyclonal antibody