DDX27 polyclonal antibody
  • DDX27 polyclonal antibody

DDX27 polyclonal antibody

Ref: AB-PAB24527
DDX27 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX27.
Información adicional
Size 100 uL
Gene Name DDX27
Gene Alias DKFZp667N057|FLJ12917|FLJ20596|FLJ22238|HSPC259|MGC1018|MGC163147|PP3241|RHLP|Rrp3p|dJ686N3.1
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 27
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX27.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55661
Iso type IgG

Enviar un mensaje


DDX27 polyclonal antibody

DDX27 polyclonal antibody