ZNF844 polyclonal antibody
  • ZNF844 polyclonal antibody

ZNF844 polyclonal antibody

Ref: AB-PAB24524
ZNF844 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF844.
Información adicional
Size 100 uL
Gene Name ZNF844
Gene Alias FLJ14959|MGC150553
Gene Description zinc finger protein 844
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPHTFKCMKGLTLESNCMNLNNVKKPLDLSETFKFMKRHTLERNPIRNMEKHSTISLPFKYMQQCTEDRMPMNVKSVTKHSYLPRSFEYMQEHTLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF844.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284391
Iso type IgG

Enviar un mensaje


ZNF844 polyclonal antibody

ZNF844 polyclonal antibody