TTPAL polyclonal antibody
  • TTPAL polyclonal antibody

TTPAL polyclonal antibody

Ref: AB-PAB24523
TTPAL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTPAL.
Información adicional
Size 100 uL
Gene Name TTPAL
Gene Alias C20orf121|DKFZp686E0870|MGC2470
Gene Description tocopherol (alpha) transfer protein-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TTPAL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79183
Iso type IgG

Enviar un mensaje


TTPAL polyclonal antibody

TTPAL polyclonal antibody