DDX60 polyclonal antibody
  • DDX60 polyclonal antibody

DDX60 polyclonal antibody

Ref: AB-PAB24522
DDX60 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX60.
Información adicional
Size 100 uL
Gene Name DDX60
Gene Alias FLJ10787|FLJ20035
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX60.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55601
Iso type IgG

Enviar un mensaje


DDX60 polyclonal antibody

DDX60 polyclonal antibody