C19orf12 polyclonal antibody
  • C19orf12 polyclonal antibody

C19orf12 polyclonal antibody

Ref: AB-PAB24519
C19orf12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf12.
Información adicional
Size 100 uL
Gene Name C19orf12
Gene Alias DKFZp762D096|MGC10922
Gene Description chromosome 19 open reading frame 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83636
Iso type IgG

Enviar un mensaje


C19orf12 polyclonal antibody

C19orf12 polyclonal antibody