RPP25 polyclonal antibody
  • RPP25 polyclonal antibody

RPP25 polyclonal antibody

Ref: AB-PAB24518
RPP25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPP25.
Información adicional
Size 100 uL
Gene Name RPP25
Gene Alias FLJ20374
Gene Description ribonuclease P/MRP 25kDa subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPP25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54913
Iso type IgG

Enviar un mensaje


RPP25 polyclonal antibody

RPP25 polyclonal antibody