NUDT14 polyclonal antibody
  • NUDT14 polyclonal antibody

NUDT14 polyclonal antibody

Ref: AB-PAB24514
NUDT14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUDT14.
Información adicional
Size 100 uL
Gene Name NUDT14
Gene Alias UGPP|UGPPase
Gene Description nudix (nucleoside diphosphate linked moiety X)-type motif 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EAWEECGYHLAPSDLRRVATYWSGVGLTGSRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPKTLGVIFGVSWFLSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUDT14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 256281
Iso type IgG

Enviar un mensaje


NUDT14 polyclonal antibody

NUDT14 polyclonal antibody