LRRC73 polyclonal antibody
  • LRRC73 polyclonal antibody

LRRC73 polyclonal antibody

Ref: AB-PAB24513
LRRC73 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC73.
Información adicional
Size 100 uL
Gene Name LRRC73
Gene Alias RP3-337H4.2|C6orf154|dJ337H4.2
Gene Description leucine rich repeat containing 73
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICRALAGATSLAQLNLNLGVVSSPSRIKQLAEALRTNRSIQSLFLHGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC73.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221424
Iso type IgG

Enviar un mensaje


LRRC73 polyclonal antibody

LRRC73 polyclonal antibody