UQCRQ polyclonal antibody
  • UQCRQ polyclonal antibody

UQCRQ polyclonal antibody

Ref: AB-PAB24512
UQCRQ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UQCRQ.
Información adicional
Size 100 uL
Gene Name UQCRQ
Gene Alias QCR8|QP-C|QPC
Gene Description ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UQCRQ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27089
Iso type IgG

Enviar un mensaje


UQCRQ polyclonal antibody

UQCRQ polyclonal antibody