FCF1 polyclonal antibody
  • FCF1 polyclonal antibody

FCF1 polyclonal antibody

Ref: AB-PAB24509
FCF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FCF1.
Información adicional
Size 100 uL
Gene Name FCF1
Gene Alias Bka|C14orf111|CGI-35|MGC99629
Gene Description FCF1 small subunit (SSU) processome component homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FCF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51077
Iso type IgG

Enviar un mensaje


FCF1 polyclonal antibody

FCF1 polyclonal antibody