RQCD1 polyclonal antibody
  • RQCD1 polyclonal antibody

RQCD1 polyclonal antibody

Ref: AB-PAB24508
RQCD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RQCD1.
Información adicional
Size 100 uL
Gene Name RQCD1
Gene Alias CNOT9|RCD1|RCD1+
Gene Description RCD1 required for cell differentiation1 homolog (S. pombe)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RQCD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9125
Iso type IgG

Enviar un mensaje


RQCD1 polyclonal antibody

RQCD1 polyclonal antibody